fuskator.com

🖥 Status: up
🕒 Response Time: 0.001 sec
⬅️ Response Code: not set
fuskator.com

Over the last 2 101 days beginning November 11, 2020, to now, fuskator.com's accessibility was checked 155 times. Responding with a code 200, fuskator.com was operational 124 times, most recently on August 10, 2026, out of every check attempted. Out of all evaluations, fuskator.com was unreachable 2.58% of the time, equaling 4 events, with the latest occurrence on December 5, 2020. Among the 27 error-containing responses, the most current error, coded as 521, was detected on April 13, 2026. The August 10, 2026, response time of 0.001 seconds for fuskator.com differed from its average of 0.557 seconds.

4.0
155
Last Updated: August 10, 2026

Fuskator overview

Domain
fuskator.com
Title
Fuskator - Just Porn Galleries, That's All
Description
Fuskator provides nude image galleries contributed by users similar to image dump sites.
S Site Status Rank
1 406
Search Wikipedia
fuskator.com
Alternatives
alternatives to fuskator.com
Recently checked
r2games.com

primatelabs.com

Last Updated: August 8, 2026
Status: up
Response Time: 0.585 sec
Response Code: 200

hochschule-rhein-waal.de

Last Updated: August 8, 2026
Status: up
Response Time: 0.086 sec
Response Code: 200

terrasport.ua

Last Updated: June 25, 2026
Status: up
Response Time: 0.774 sec
Response Code: 200

mindvalleyrussian.com

Last Updated: June 8, 2026
Status: up
Response Time: 0.369 sec
Response Code: 200

tldsb.on.ca

Last Updated: May 9, 2026
Status: error
Response Time: 0.452 sec
Response Code: 403

super-ppl.com

Last Updated: April 13, 2026
Status: error
Response Time: 0.024 sec
Response Code: 403

onlinebanking-psd-nuernberg.de

Last Updated: July 1, 2026
Status: up
Response Time: 0.131 sec
Response Code: 200

Fuskator.com
status check request map as of August 14, 2026

fuskator.com request, August 10, 2026

Country report for fuskator.com as of August 14, 2026

Other Countries 100.00%
14:07
SiteTotal ChecksLast Modified
verycd.comverycd.com44January 28, 2021
r2games.comr2games.com43January 28, 2021
fuskator.comfuskator.com155November 11, 2020
questionablecontent.netquestionablecontent.net51January 28, 2021
thumbtack.comthumbtack.com33January 28, 2021

Mindvalleyrussian.com

Fuskator.com

General SEO Report

Page TitlePage Title tips for fuskator.com: Frequently review and update your website title tags on a quarterly basis as part of your ongoing SEO strategy; this practice allows you to adapt to evolving search engine algorithms, leverage new keyword trends emerging within your niche, and ensure you never miss out on optimizing these critical on-page ranking factors.
Fuskator - Just Porn Galleries, That's All

Length: 47 characters
Meta DescriptionMeta Description tips for fuskator.com: Don't underestimate the power of a good meta description; it significantly impacts click-through rates by providing a clear preview of your page, naturally integrating primary keywords and encouraging searchers to visit your website immediately
Fuskator provides nude image galleries contributed by users similar to image dump sites.

Length: 88 characters
Meta KeywordsMeta Keywords tips for fuskator.com: Auditing website code for meta keywords might uncover outdated elements, but removing them provides no SEO lift and should be done immediately, focusing attention on other factors instead.
no meta keywords data for fuskator.com
2026-08-14T08:27:24+00:00
Page ContentPage Content tips for fuskator.com: Design page content specifically tailored to different landing page intents, optimizing conversion copy, form placements, and clear instructions for users arriving via specific marketing campaigns.
Web Page Content Length: 30355 characters
H1 HeadingH1 Heading tips for fuskator.com: Consistent branding elements can be woven into your H1 headers, such as including your company name or product line if relevant to the specific page's topic, strengthening brand recognition while still maintaining focus on the page's immediate content relevance.
no h1 heading data for fuskator.com
2026-08-14T08:27:24+00:00
H2 HeadingsH2 Headings tips for fuskator.com: Strategically place H2 tags to break up dense text content, improve page load perception (as visual cues), and guide readers smoothly through your information architecture.
no h2 headings data for fuskator.com
2026-08-14T08:27:24+00:00
H3 HeadingsH3 Headings tips for fuskator.com: Ensure consistent application of H3 tags throughout your website's documentation or informational pages; avoid overusing or misusing them for styling alone, preserving their structural importance for SEO and clear information hierarchy.
no h3 headings data for fuskator.com
2026-08-14T08:27:24+00:00
H4 HeadingsH4 Headings tips for fuskator.com: Consider the overall page load speed implications; while H4 tags themselves don't directly affect speed, ensuring the surrounding content optimized for fast loading complements their use, as page speed is a ranking factor influencing user experience.
no h4 headings data for fuskator.com
2026-08-14T08:27:24+00:00
H5-H6 HeadingsH5-H6 Headings tips for fuskator.com: For e-commerce category pages or comparison charts, use H5-H6 headers to clearly define different product attributes, features, pros/cons, or specification tables for better user comprehension.
no h5-h6 headings data for fuskator.com
2026-08-14T08:27:24+00:00
Image ALT AttributesImage ALT Attributes tips for fuskator.com: Avoid overly generic or vague descriptions for your Image ALT attributes; instead, be specific about the subject matter, composition, and context, which directly informs both assistive technology users and search engines about the image's relevance and quality.
no image alt attributes data for fuskator.com
2026-08-14T08:27:24+00:00
Robots.txtRobots.txt tips for fuskator.com: Develop a clear understanding of the robots.txt syntax rules and escape sequences before implementing complex directives affecting your site's navigation and crawl efficiency, ensuring you target only necessary resources and exclude critical pages from blocking.
file robots.txt was found on the website
XML SitemapXML Sitemap tips for fuskator.com: Clients managing large websites for businesses must understand that submitting an XML sitemap isn't optional but an essential technical SEO task that encourages thorough and frequent crawling, leading to more comprehensive indexing, improved search ranking potential, and ultimately, higher conversion rates.
https://fuskator.com/sitemap_gallery.xml
https://fuskator.com/sitemap_gallery2.xml
https://fuskator.com/sitemap_gallery3.xml
https://fuskator.com/sitemap_gallery4.xml
https://fuskator.com/sitemap_gallery5.xml
https://fuskator.com/sitemap_gallery6.xml
https://fuskator.com/sitemap_gallery7.xml
https://fuskator.com/sitemap_gallery8.xml


available for crawling
Page SizePage Size tips for fuskator.com: While high-resolution images enhance quality, they often inflate page size; use responsive images and appropriate lazy loading techniques to maintain visual appeal without sacrificing loading performance or SEO benefits.
page size: 30 kb
Response TimeResponse Time tips for fuskator.com: Reduce website server response time significantly by upgrading to faster hardware, enabling Gzip/Brotli compression for transferred data, and optimizing server location for quicker request processing and delivery to users.
response time: 0.557 sec
Minify CSSMinify CSS tips for fuskator.com: Consistently failing to minify CSS significantly hinders your ability to offer a snappy, efficient user experience and can directly penalize your website's ranking potential based on Core Web Vitals, underscoring the importance of implementing standard, best-practice minification techniques for reliable frontend performance.
Minified:
/css/vendor.min.css?1.3.43
/css/fuskator.min.css?1.3.43


included in the page
Minify JavaScriptMinify JavaScript tips for fuskator.com: Yes, users are sometimes asked to enable content; however, aggressive JS code minification empowers them to experience applications faster across almost all devices, boosting satisfaction crucially for SEO.
Minified:
/scripts/vendor.min.js?1.3.43
/scripts/global.min.js?1.3.43
/scripts/app.min.js?1.3.43
/ea.js


detected during site scan
Structured DataStructured Data tips for fuskator.com: The strategic use of diverse Schema Meta Data types across various website sections can significantly improve domain authority signals for specific long-tail keywords, leading to enhanced organic search ranking performance over time.
no structured data data for fuskator.com
2026-08-14T08:27:24+00:00
CDN UsageCDN Usage tips for fuskator.com: Leverage HTTP/3 and QUIC protocol optimizations offered by modern Content Delivery Networks to accelerate asset retrieval compared to older HTTP/1.1 versions, thereby delivering critical resources like a CSS framework's core file faster than any single website server could alone.
no cdn usage data for fuskator.com
2026-08-14T08:27:24+00:00
SSL certificatesSSL certificates tips for fuskator.com: A healthy website reputation relies heavily on demonstrating strong data protection through the visible use of security certificates (SSL/TLS), explicitly building credibility with potential customers accessing your business or service online.
SSL is enabled on the website

Estimated Traffic

Minimum Daily Unique Visitors:117 277
Minimum Daily Visits:137 059
Minimum Daily Page Views:235 968
Minimum Monthly Unique Visitors:3 518 310
Minimum Monthly Visits:4 111 770
Minimum Monthly Page Views:7 079 040
Minimum Yearly Unique Visitors:42 219 720
Minimum Yearly Visits:49 341 240
Minimum Yearly Page Views:84 948 480
Maximum Daily Unique Visitors:148 363
Maximum Daily Visits:158 254
Maximum Daily Page Views:267 053
Maximum Monthly Unique Visitors:4 450 890
Maximum Monthly Visits:4 747 620
Maximum Monthly Page Views:8 011 590
Maximum Yearly Unique Visitors:53 410 680
Maximum Yearly Visits:56 971 440
Maximum Yearly Page Views:96 139 080

Estimated Valuation

Daily Revenue:US$ 170 - 382
Monthly Revenue:US$ 5 100 - 11 460
Yearly Revenue:US$ 61 200 - 137 520

Estimated Worth

Minimum:US$ 91 800
Maximum:US$ 412 560

Similarly Ranked Sites

RankPoints
plaync.complaync.com5 4003 647 772
nchsoftware.comnchsoftware.com5 4013 647 771
desjardins.comdesjardins.com5 4023 647 771
verycd.comverycd.com5 4033 647 771
r2games.comr2games.com5 4043 647 770
fuskator.comfuskator.com5 4053 647 770
questionablecontent.netquestionablecontent.net5 4063 647 770
thumbtack.comthumbtack.com5 4073 647 770
watchmygirlfriend.tvwatchmygirlfriend.tv5 4083 647 769
lever.colever.co5 4093 647 769
game-game.com.uagame-game.com.ua5 4103 647 769